Rashi Khanna Wallpapers HD 2019 icon

Rashi Khanna Wallpapers HD 2019

1.2 for Android
3.8 | 5,000+ 설치 수

bmks services

설명 Rashi Khanna Wallpapers HD 2019

Rashi Khanna Wallpapers HD 2019 app is to not only setting Rashi Khanna photos as wallpapers but also share & save selected favorite image.
Rashi Khanna got her fame from Oohalu Gusagusalade, Bengal Tiger, Hyper, Supreme, Jai Lava Kusa, Tholi Prema, Imaikkaa Nodigal, Adanga Maru..etc Telugu and Tamil movies in Tollywood and Kollywood.
You can express your love towards Rashi Khanna with others by sharing this Rashi Khanna wallpapers HD!
Rashi Khanna Wallpapers HD , We all love Rashi Khanna ! Welcome to the world of beautiful Rashi Khanna. Here you can find some very beautiful Rashi Khanna wallpaper for your phones and tablets.
You can save your favorite Rashi Khanna image onto your mobile device and set them as lock screens and wallpapers.
Features of Rashi Khanna Wallpapers HD 2019 App:
1.You can set the beautiful Rashi Khanna image as wallpaper.
2. You can save your liked Rashi Khanna wallpaper to your gallery.
3. You can add Rashi Khanna wallpaper to your favorites and can go through the selected wallpapers easily from your favorites than searching in the entire gallery., so it can save your time.
4. You can share your favorite Rashi Khanna wallpaper with your friends through watsapp, hike, share it, bluetooth, facebook..etc
5. You can zoom Rashi Khanna image.
There are lots of background pictures of pretty Rashi Khanna.
This application is made for only one purpose and it is fun or entertainment.
With Rashi Khanna Wallpapers HD, Make your phone looks attractive by setting HD Images of Rashi Khanna. Amazing Lovely Background, you can choose any photo and set as your home screen in a click away.
Disclaimer
The content provided in this app is available in public domain & Web. We do not upload any images or not showing any modified content. If any image wants to be removed from the App or if any images we linked is unauthorized or violating copyrights., Please send mail to bmpksservices@gmail.com with specific image and We will Remove the image ASAP. Please email us if any images we linked is unauthorized or violating copyrights.
contact email : bmpksservices@gmail.com

정보

  • 범주:
    맞춤 설정
  • 현재 버전:
    1.2
  • 업데이트 날짜:
    2018-12-15
  • 크기:
    12.4MB
  • 필요한 Android 버전:
    Android 4.0.3 or later
  • 개발자:
    bmks services
  • ID:
    com.bmksservices.rashikhannawallpapershd
  • Available on: